PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1091120.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 622aa    MW: 70311.9 Da    PI: 4.5717
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1091120.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.33.1e-49161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp GfrF+P+de++++ yL++k++++  ++  vi+e+d++k+ePw+Lp  + +++++ ew+fF++ d+ky++g+r +rat +gyWkatg d+++
  Lj1g3v1091120.2  16 LPLGFRFQPSDEDIIDLYLRQKINNNGDDV-WVIREIDVCKWEPWELPdfSVIRNKDPEWFFFCPLDRKYPNGNRLKRATGHGYWKATGIDRKI 108
                      699************************999.89***************6437777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +s +++l+g+kktLvfy+grapkg++t+Wvmheyr 
  Lj1g3v1091120.2 109 KS-GSSLIGMKKTLVFYHGRAPKGKRTNWVMHEYRT 143
                      **.99*****************************96 PP

2NAM153.11.2e-472403661127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp  +rF+P+dee++++yL++k++g+  ++  vi+e+d++k+ePwdLp  + +++++ ew+fF+++d+ky++g+  nrat++g+Wkatg+d++v
  Lj1g3v1091120.2 240 LPIAIRFRPSDEEIIDFYLRQKINGNGDDV-WVIREIDVCKWEPWDLPdlSVIRNKDPEWFFFCPQDRKYPNGNLVNRATEHGFWKATGRDRKV 332
                      57889**********************999.89**************96447777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +s +++l+g+kktLvfy+grap+g++t+Wvmhey+
  Lj1g3v1091120.2 333 KS-GSSLIGIKKTLVFYNGRAPRGKRTNWVMHEYQ 366
                      **.99*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-588166IPR003441NAC domain
PROSITE profilePS5100553.96716166IPR003441NAC domain
PfamPF023654.1E-2417142IPR003441NAC domain
SuperFamilySSF1019414.18E-56234390IPR003441NAC domain
PROSITE profilePS5100552.671240390IPR003441NAC domain
PfamPF023652.5E-24242366IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MGVVETAMPV LSLNSLPLGF RFQPSDEDII DLYLRQKINN NGDDVWVIRE IDVCKWEPWE  60
LPDFSVIRNK DPEWFFFCPL DRKYPNGNRL KRATGHGYWK ATGIDRKIKS GSSLIGMKKT  120
LVFYHGRAPK GKRTNWVMHE YRTTLQELDG TNPGQNPYVI CRLFKKHDES IEVSNCGEVE  180
QTASTPIAAK YCPEEVQSDT PLPVVALSSS LLTENVKPKP IIPETSEETT SKPVLSLNSL  240
PIAIRFRPSD EEIIDFYLRQ KINGNGDDVW VIREIDVCKW EPWDLPDLSV IRNKDPEWFF  300
FCPQDRKYPN GNLVNRATEH GFWKATGRDR KVKSGSSLIG IKKTLVFYNG RAPRGKRTNW  360
VMHEYQPTLQ ELDGTNPGQN PYVICRLFKK QDESIEVSNC GEVEKTASTP MAAKYSPEDV  420
QSDTPLPPVA VSSSLLTEDK TQAIIRETSE ETTSNIITPV DRNSDEYDAH NAQPQNVKLA  480
LEENQLLNSD IFSDLENDLF DDILFSPALV HLPQVFDYQA SNEPDGLSGL QYGTNETGIS  540
DLFESLTSDQ LSYEETGSQP MNYPLFNVKD SGWGSDSDLK VTNMPSMQVP YPEEAMDRNV  600
PLGTAPEFFS TVGVPFDHSA VE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-4213944169NAC domain-containing protein 19
4dul_A1e-4213944169NAC domain-containing protein 19
1ut7_B1e-4213944169NO APICAL MERISTEM PROTEIN
1ut7_A1e-4213944169NO APICAL MERISTEM PROTEIN
1ut4_B1e-4213944169NO APICAL MERISTEM PROTEIN
1ut4_A1e-4213944169NO APICAL MERISTEM PROTEIN
3swp_D2e-4213947172NAC domain-containing protein 19
3swp_C2e-4213947172NAC domain-containing protein 19
3swp_B2e-4213947172NAC domain-containing protein 19
3swp_A2e-4213947172NAC domain-containing protein 19
3swm_D2e-4213947172NAC domain-containing protein 19
3swm_C2e-4213947172NAC domain-containing protein 19
3swm_B2e-4213947172NAC domain-containing protein 19
3swm_A2e-4213947172NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.125190.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096580.0AP009658.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT41E18, TM0207, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571948.10.0PREDICTED: uncharacterized protein LOC101492664 isoform X2
SwissprotF4JN352e-83NTL9_ARATH; Protein NTM1-like 9
TrEMBLG7J9300.0G7J930_MEDTR; NAC transcription factor-like protein
TrEMBLG7J9310.0G7J931_MEDTR; NAC transcription factor-like protein
STRINGGLYMA04G40450.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.22e-84NAC transcription factor-like 9